MIPO1_MOUSE   Q9D9F8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D9F8

Recommended name:Mirror-image polydactyly gene 1 protein homolog

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):Mipol1

Gene names  (synonym ):

Gene names  (ORF ):

Length:279

Mass:31751

Sequence:MNSEQSIRELGNEVPSEDLELPGRKTSNFQVLQPCRDEGASAECSIVECGKNYEPVISHQVIPDLNKETSVAYLQKELEILRASNTKLQEKLAKEDKEKRRLKLKLELQEKAAEADIAERTAALVEEVYFAQRERDEAIMCRLQLALKERDEAIAHVKHMEMSLKMLENINPKENDMTLQELLDRINNADTGIAIQKNGAVIVDTIYKTTGCRKRITAEEMSAVLEERDAALSQCKQLHQRLLDLKKQNQTSTNNTKHPTAKNNQEHTLKYNLNIASIN

Tissue specificity:

Induction:

Developmental stage:Expressed in embryo between 10.5 and 13.5 dpc. {ECO:0000269|PubMed:11954550}.

Protein families:


   💬 WhatsApp