UBD_RAT   Q921A3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q921A3

Recommended name:Ubiquitin D

EC number:

Alternative names:

Cleaved into:

GeneID:29168

Gene names  (primary ):Ubd

Gene names  (synonym ):Fat10

Gene names  (ORF ):

Length:161

Mass:17,983

Sequence:MASCVCVVRSEQWPLMTFDTTMSDKVKKINEHIRSQTKVSVQDQILLLDSKILKPHRALSSYGIDKENTIHLTLKVVKPSDEELPLSLVESGDEGQRHLLRVRRSSSVAQVKEMIENVTAVPPKKQIVNCNGKRLEDGKIMADYNIKSGSLLFLTAHCIGG

Tissue specificity:Possible cell-cycle regulation with highest expression during the S-phase (at protein level). Probably rapidly degraded by the proteasome.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp