C209A_MOUSE Q91ZX1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91ZX1
Recommended name：CD209 antigen-like protein A
EC number：
Alternative names：(Dendritic cell-specific ICAM-3-grabbing non-integrin) (DC-SIGN) (CD antigen CD209)
Cleaved into：
GeneID：170786
Gene names (primary )：Cd209a
Gene names (synonym )：Cire
Gene names (ORF )：
Length：238
Mass：27149
Sequence：MSDSKEMGKRQLRPLDEELLTSSHTRHSIKGFGFQTNSGFSSFTGCLVHSQVPLALQVLFLAVCSVLLVVILVKVYKIPSSQEENNQMNVYQELTQLKAGVDRLCRSCPWDWTHFQGSCYFFSVAQKSWNDSATACHNVGAQLVVIKSDEEQNFLQQTSKKRGYTWMGLIDMSKESTWYWVDGSPLTLSFMKYWSKGEPNNLGEEDCAEFRDDGWNDTKCTNKKFWICKKLSTSCPSK
Tissue specificity：Predominantly expressed in dendritic cells. Detected at very low levels in lung, spleen, lymph nodes and bone marrow. {ECO:0000269|PubMed:11581173, ECO:0000269|PubMed:11684292}.
Induction：Down-regulated upon activation of dendritic cells. {ECO:0000269|PubMed:11684292}.
Developmental stage：
Protein families：