PRD12_MOUSE A2AJ77
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:A2AJ77
Recommended name：PR domain zinc finger protein 12
EC number：EC 2.1.1.-
Alternative names：(PR domain-containing protein 12)
Cleaved into：
GeneID：381359
Gene names (primary )：Prdm12
Gene names (synonym )：Gm998
Gene names (ORF )：
Length：365
Mass：40303
Sequence：MMGSVLPAEALVLKTGLKAPGLALAEVITSDILHSFLYGRWRNVLGEQLLEDKSHHASPKTAFTAEVLAQSFSGEVQKLSSLVLPVEVIIAQSSIPGEGLGIFSKTWIKAGTEMGPFTGRVIAPEHVDICKNNNLMWEVFNEDGTVRYFIDASQEDHRSWMTYIKCARNEQEQNLEVVQIGTSIFYKAIEMIPPDQELLVWYGNSHNTFLGIPGVPGLEEEQKKNKHEDFHPADSATGTAGRMRCVICHRGFNSRSNLRSHMRIHTLDKPFVCRFCNRRFSQSSTLRNHVRLHTGERPYKCQVCQSAYSQLAGLRAHQKSARHRPPSTALQAHSPALPAPHAHAPALAAAAAAAAAAHHLPAMVL
Tissue specificity：
Induction：
Developmental stage：Expression starts around 9.0 dpc in the neural folds, which give rise to neural crest cells. Neural crest cells develop into various tissues, including the sensory ganglia that contain nociceptor cell bodies. Prominently expressed in sensory spinal ganglia (dorsal root ganglia) but not in sympathetic ganglia during the time when sensory neurons emerge (10.5 dpc-13.5 dpc), mature and differentiate (14.5 dpc-postnatal day 14). {ECO:0000269|PubMed:26005867}.
Protein families：Class V-like SAM-binding methyltransferase superfamily