PAX5_MOUSE   Q02650


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q02650

Recommended name:Paired box protein Pax-5

EC number:

Alternative names:(B-cell-specific transcription factor) (BSAP)

Cleaved into:

GeneID:18507

Gene names  (primary ):Pax5

Gene names  (synonym ):Pax-5

Gene names  (ORF ):

Length:391

Mass:42231

Sequence:MDLEKNYPTPRTIRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLTSPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYYSPAARGAAPPAAATAYDRH

Tissue specificity:

Induction:

Developmental stage:Expressed at early B-cell differentiation, in the developing CNS and in adult testis.

Protein families:


   💬 WhatsApp