CSN8_MOUSE Q8VBV7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VBV7
Recommended name：COP9 signalosome complex subunit 8
EC number：
Alternative names：(SGN8) (Signalosome subunit 8) (COP9 homolog) (JAB1-containing signalosome subunit 8)
Cleaved into：
GeneID：108679
Gene names (primary )：Cops8
Gene names (synonym )：Csn8
Gene names (ORF )：
Length：209
Mass：23256
Sequence：MPVAVMADNAFSFRKLLDQCENQELEAPGGIATPPVYGQLLALYLLQNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGVLEQGWQADSTTRMVLPRKPASGTLDVSLNRFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN
Tissue specificity：Widely expressed. {ECO:0000269|PubMed:14636993}.
Induction：
Developmental stage：Expressed in embryonic stem (ES) cells and throughout early embryo development from zygote, preimplantation embryos, to post-implantation embryos. Predominantly expressed in the inner cell mass (ICM) of 3.5 dpc blastocyst and widely expressed in 9.5 dpc embryos. {ECO:0000269|PubMed:14636993}.
Protein families：CSN8 family