F243A_HUMAN B9A014
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:B9A014
Recommended name：Protein FAM243A
EC number：
Alternative names：
Cleaved into：
GeneID：101928147
Gene names (primary )：FAM243A
Gene names (synonym )：C21orf140
Gene names (ORF )：
Length：251
Mass：29214
Sequence：MPRFASPLLRNVIIRSQFDGIKRKQCLQYLKTLRTLQYDGFKTVYFGETNIPESLVTGEDISDGYFIQTPTWCIVHAAGSQGWVPWKYRVFLRDELCIKQEDSLFSEFCDVVRKAYGKCVIVVKERRQQEEQRPKEDREAEGQFYIPTVISLASIMCCPEVAKSCGHELLSLPSPCNYLNPLDSAWSSLKWFIINNRNEFCLQSIDSGYSYQCILFSNLISKGIERINASKWRTLTSKVRRWENYYLGKFS
Tissue specificity：
Induction：
Developmental stage：
Protein families：FAM243 family