UCHL3_MOUSE Q9JKB1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JKB1
Recommended name:Ubiquitin carboxyl-terminal hydrolase isozyme L3
EC number:EC 3.4.19.12
Alternative names:(UCH-L3) (Ubiquitin thioesterase L3)
Cleaved into:
GeneID:50933
Gene names (primary ):Uchl3
Gene names (synonym ):
Gene names (ORF ):
Length:230
Mass:26152
Sequence:MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMEPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERAKFLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGKTSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
Tissue specificity:Ubiquitously expressed, with highest levels in brain, liver, heart, thymus, kidney and testis. Highly expressed in the cauda epididymidis, in meiotic pachytene spermatocytes and post-meiotic spematids. In the retina, enriched in the photoreceptor inner segment. {ECO:0000269|PubMed:10713173, ECO:0000269|PubMed:11341770, ECO:0000269|PubMed:16816367, ECO:0000269|PubMed:17460351}.
Induction:
Developmental stage:Expressed at 8.5 dpc in structures required for skeletal patterning. Highly expressed at 11 dpc, and decreases markedly from 15 dpc. {ECO:0000269|PubMed:10713173, ECO:0000269|PubMed:9790970}.
Protein families:Peptidase C12 family