MDHC_RAT   O88989


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O88989

Recommended name:Malate dehydrogenase, cytoplasmic

EC number:EC:1.1.1.37

Alternative names:Aromatic alpha-keto acid reductase Curated (KAR Curated) (EC:1.1.1.96 By Similarity) . EC:1.1.1.96 (UniProtKB | ENZYME | Rhea) By Similarity Cytosolic malate dehydrogenase

Cleaved into:

GeneID:24551

Gene names  (primary ):Mdh1

Gene names  (synonym ):Mdh

Gene names  (ORF ):

Length:334

Mass:36,483

Sequence:MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLQDVIATDKEEVAFKDLDVAVLVGSMPRREGMERKDLLKANVKIFKSQGAALEKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKSQIALKLGVTADDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAISDHIRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKETAFEFLSSA

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp