CP341_MOUSE Q9JMA7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JMA7
Recommended name：Cytochrome P450 3A41
EC number：EC 1.14.14.1
Alternative names：
Cleaved into：
GeneID：100041375
Gene names (primary )：Cyp3a41a; Cyp3a41b
Gene names (synonym )：Cyp3a41;
Gene names (ORF )：;
Length：504
Mass：57987
Sequence：MNLFSALSLDTWVLLAIILVLLYRYGTRTHGLFKKQGIPGPKPLPFLGTVLNYYKGLWKFDMECYEKYGKTWGLFDGQMPLFVITDPEMIKNVLVKECFSVFTNRREFGPVGIMSKAISISKDEEWKRYRALLSPTFTSGKLKEMFPVIEQYGDILVKYLMQEAEKGKPVTMKDVLGAYSIDVITSTSFGVNVDSLNNPEDPFVEKAKGILRVDFFDPLVFSVVLFPFLTPVYEMLNICMFPKDSIEFFKKFVNRMKESRLDSKQKHRVDFLQLMMNAHNNSKDKDSHKALSDMEITAQSIVFIFAGYETTSSTLSFTLYCLATHPDIQKKLQEEIDETLPNKAPPTYDTVMEMEYLDMVLNETLRLYPIGNRLERFCKKDVELNGVYIPKGSTVMIPSYALHHDPQHWPEPEEFQPERFSKENKGSIDPYLYMPFGIGPRNCIGMRFAFMTMKLALTKVMQNFSFQPCQETQIPLKLSRQGLLQPEKPIVLKVVPRDVVITGA
Tissue specificity：Expressed in liver. Also expressed in the kidneys of female mice, with traces in the stomach, ovary, and heart of female mice and in the testis of male mice.
Induction：
Developmental stage：Detected immediately after birth in the livers of animals of both sexes, but increases with age in females, whereas it is gradually reduced in males, resulting in predominantly female-specific expression in livers.
Protein families：Cytochrome P450 family