PA2GC_MOUSE   P48076


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P48076

Recommended name:Group IIC secretory phospholipase A2

EC number:EC 3.1.1.4

Alternative names:(GIIC sPLA2) (sPLA2-IIC) (14 kDa phospholipase A2) (PLA2-8) (Phosphatidylcholine 2-acylhydrolase 2C)

Cleaved into:

GeneID:18781

Gene names  (primary ):Pla2g2c

Gene names  (synonym ):

Gene names  (ORF ):

Length:150

Mass:16983

Sequence:MKGIAIFLVFIFYWTTSTLSSFWQFQRMVKHVTGRSAFFSYYGYGCYCGLGGKGLPVDATDRCCWAHDCCYHKLKEYGCQPILNAYQFTIVNGTVTCGCTVASSCPCGQKACECDKQSVYCFKENLATYEKAFKQLFPTRPQCGRDKLQC

Tissue specificity:Testis specific.

Induction:

Developmental stage:Expressed mainly in pachytene and secondary spermatocytes and round spermatids and predominates in stage VI-VII tubules.

Protein families:Phospholipase A2 family


   💬 WhatsApp