BL1S6_RAT   Q4V8A6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q4V8A6

Recommended name:Biogenesis of lysosome-related organelles complex 1 subunit 6

EC number:

Alternative names:Pallid protein homolog Pallidin

Cleaved into:

GeneID:317630

Gene names  (primary ):Bloc1s6

Gene names  (synonym ):Pldn

Gene names  (ORF ):

Length:172

Mass:19,703

Sequence:MNVPVPPPPDGVLTGPSDSLEAGEPTPGLSDRSPDEGLIEDLALEDRAVEHLVGGLLSHYLPDLQRSKRALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFTEAKHYHAKLVTIRKEMLLLHEKTSKLKKRALKLQQQRQKEELEREQQREREFEREKQLTAKPAKRT

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp