CORT_MOUSE   P56469


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P56469

Recommended name:Cortistatin [Cleaved into: Cortistatin-14]

EC number:

Alternative names:

Cleaved into:

GeneID:12854

Gene names  (primary ):Cort

Gene names  (synonym ):

Gene names  (ORF ):

Length:109

Mass:11613

Sequence:MMGGRGTGGKWPSAFGLLLLWGVAASALPLESGPTGQDSVQEATEGRSGLLTFLAWWHEWASQASSSTPVGGGTPGLSKSQERPPPQQPPHLDKKPCKNFFWKTFSSCK

Tissue specificity:Expressed in a subset of GABAergic cells in the cortex and hippocampus.

Induction:Not induced by kainate. {ECO:0000269|PubMed:10521599}.

Developmental stage:

Protein families:Somatostatin family


   💬 WhatsApp