H11_RAT D4A3K5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:D4A3K5
Recommended name：Histone H1.1
EC number：
Alternative names：
Cleaved into：
GeneID：291145
Gene names (primary )：H1-1 By Similarity
Gene names (synonym )：Hist1h1a Imported
Gene names (ORF )：
Length：214
Mass：22,004
Sequence：MSETAPVPQPASVAPEKPAATKKTRKPAKAAVPRKKPAGPSVSELIVQAVSSSKERSGVSLAALKKSLAAAGYDVEKNNSRIKLGLKSLVNKGTLVQTKGTGAAGSFKLNKKAESKASTTKVTVKAKASGAAKKPKKTAGAAAKKTVKTPKKPKKPAVSKKTSSKSPKKPKVVKAKKVAKSPAKAKAVKPKAAKVKVTKPKTPAKPKKAAPKKK
Tissue specificity：
Induction：
Developmental stage：
Protein families：histone H1/H5 family