ATF3_RAT   P29596


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P29596

Recommended name:Cyclic AMP-dependent transcription factor ATF-3

EC number:

Alternative names:Activating transcription factor 3 Liver regeneration factor 1 1 Publication (LRF-1 1 Publication)

Cleaved into:

GeneID:25389

Gene names  (primary ):Atf3

Gene names  (synonym ):Lrf1 1 Publication

Gene names  (ORF ):

Length:181

Mass:20,764

Sequence:MMLQHPGQVSASEVSATAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTINNRPLEMSVTKSEVAPEEDERKRRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS

Tissue specificity:Expressed in tissues containing skeletal muscle or smooth muscle (PubMed:1902565). Expressed in cutaneous and muscular sensory neurons (PubMed:19913522). 2 s

Induction:

Developmental stage:Up-regulated in regenerating neurons after nerve injury (PubMed:19913522). Rapidly and highly induced in regenerating liver and mitogen-stimulated cells (PubMed:1902565). 2 s

Protein families:


   💬 WhatsApp