BL1S6_MOUSE   Q9R0C0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9R0C0

Recommended name:Biogenesis of lysosome-related organelles complex 1 subunit 6

EC number:

Alternative names:(BLOC-1 subunit 6) (Pallid protein) (Pallidin) (Syntaxin 13-interacting protein)

Cleaved into:

GeneID:18457

Gene names  (primary ):Bloc1s6

Gene names  (synonym ):P2 Pa Pldn

Gene names  (ORF ):

Length:172

Mass:19682

Sequence:MSVPEPPPPDGVLTGPSDSLEAGEPTPGLSDTSPDEGLIEDFPVDDRAVEHLVGGLLSHYLPDLQRSKRALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFTEAKHYHAKLVTIRKEMLLLHEKTSKLKKRALKLQQKRQREELEREQQREKEFEREKQLTAKPAKRT

Tissue specificity:Expressed in liver, kidney and spleen (at protein level). Ubiquitously expressed, with the highest expression levels observed in brain, heart, liver and kidney. {ECO:0000269|PubMed:10610180, ECO:0000269|PubMed:12019270, ECO:0000269|PubMed:12191018}.

Induction:

Developmental stage:

Protein families:BLOC1S6 family


   💬 WhatsApp