ANG4_MOUSE Q3TMQ6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3TMQ6
Recommended name：Angiogenin-4
EC number：EC 3.1.27.-
Alternative names：
Cleaved into：
GeneID：219033
Gene names (primary )：Ang4
Gene names (synonym )：
Gene names (ORF )：
Length：144
Mass：16425
Sequence：MTMSPCPLLLVFVLGLVVIPPTLAQNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP
Tissue specificity：Detected in small intestine, caecum and colon, with the highest expression in Paneth cells in the intestinal epithelium. {ECO:0000269|PubMed:12548285}.
Induction：Up-regulated in small intestine by contact with normal intestinal microflora. Expressed at very low levels in intestine from germ-free mice. {ECO:0000269|PubMed:12548285}.
Developmental stage：
Protein families：Pancreatic ribonuclease family