CTHR1_RAT Q8CG08
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8CG08
Recommended name：Collagen triple helix repeat-containing protein 1
EC number：
Alternative names：
Cleaved into：
GeneID：282836
Gene names (primary )：Cthrc1
Gene names (synonym )：
Gene names (ORF )：
Length：245
Mass：26,424
Sequence：MHPQGRAASPQLLLGLFLVLLLLLQLSAPSSASENPKVKQKALIRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPELNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK
Tissue specificity：Expressed after injury in the carotid arteries (at protein level). Expressed in brain, lung, and after injury in fibroblasts of the adventitia and the neointima of the arteries. 1
Induction：
Developmental stage：Strongly induced in carotid arteries after injury (balloon catheter injury model). By various growth factor (BMP4, TGFB1) in NIH 3T3 cell line. 1
Protein families：