TPRG1_MOUSE Q8CB49
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8CB49
Recommended name：Tumor protein p63-regulated gene 1 protein
EC number：
Alternative names：(Protein FAM79B)
Cleaved into：
GeneID：71338
Gene names (primary )：Tprg1
Gene names (synonym )：Fam79b Tprg
Gene names (ORF )：
Length：279
Mass：31269
Sequence：MSTIGSFDGFQPVSLKQEEEDQPSENDHLSTKEGNSGKDPGSRRISRQQSITKATLYPNPYRQPYVSRKYFVTRPGAIETAVEDLKGHIAQTSGETVQGFWLLTEIDHWNNEKEKILLLTDKTLLICKYDFIMLSCVQVQQVPLNAICCICLGKFVFPGMSLDKRPGDGLRIFWGSTEGWSLLSRWNPWSTEVPYATFTEHPMKQTSEKFLEICKLSEFTSKLVPAIENAHKNSAGSGSGKELVVLTQPILIETYTGLMSFIGNRNKLGYSLARGSIGF
Tissue specificity：Highly expressed in skin. Also detected at low levels in tongue and esophagus. {ECO:0000269|PubMed:18256694}.
Induction：
Developmental stage：Detected from embryonic stage 15.5 onwards. At stage 17.5 dpc, detected in epidermis and developing hair follicles. Expression levels in skin increase 4 days after birth and are mainly restricted to differentiated layers of the epidermis.
Protein families：TPRG1 family