VAMP5_MOUSE   Q9Z2P8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Z2P8

Recommended name:Vesicle-associated membrane protein 5

EC number:

Alternative names:(VAMP-5) (Myobrevin)

Cleaved into:

GeneID:53620

Gene names  (primary ):Vamp5

Gene names  (synonym ):

Gene names  (ORF ):

Length:102

Mass:11416

Sequence:MAGKELKQCQQQADEVTEIMLNNFDKVLERHGKLAELEQRSDQLLDMSSAFSKTTKTLAQQKRWENIRCRVYLGLAVAVGLLIILIVLLVVFLPSGGDSSKP

Tissue specificity:Preferentially expressed in the skeletal muscle and heart, detected at lower levels in several other tissues but not in the brain.

Induction:During myogenesis.

Developmental stage:

Protein families:Synaptobrevin family


   💬 WhatsApp