CCL24_MOUSE Q9JKC0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JKC0
Recommended name：C-C motif chemokine 24
EC number：
Alternative names：(Eosinophil chemotactic protein 2) (Eotaxin-2) (Small-inducible cytokine A24)
Cleaved into：
GeneID：56221
Gene names (primary )：Ccl24
Gene names (synonym )：Scya24
Gene names (ORF )：
Length：119
Mass：12871
Sequence：MAGSATIVAGLLLLVACACCIFPIDSVTIPSSCCTSFISKKIPENRVVSYQLANGSICPKAGVIFITKKGHKICTDPKLLWVQRHIQKLDAKKNQPSKGAKAVRTKFAVQRRRGNSTEV
Tissue specificity：Highest expression in jejunum and spleen. Lower levels found in liver and lung. No expression detected in kidney, thymus, brain or testis. {ECO:0000269|PubMed:11067944}.
Induction：By interleukin-4 and allergen challenge with A.fumigatus. {ECO:0000269|PubMed:11067944}.
Developmental stage：
Protein families：Intercrine beta (chemokine CC) family