ERI1_MOUSE   Q7TMF2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7TMF2

Recommended name:3'-5' exoribonuclease 1

EC number:EC 3.1.-.-

Alternative names:(3'-5' exonuclease ERI1) (Eri-1 homolog) (Histone mRNA 3'-exonuclease 1)

Cleaved into:

GeneID:67276

Gene names  (primary ):Eri1

Gene names  (synonym ):3'exo Thex1

Gene names  (ORF ):

Length:345

Mass:39493

Sequence:MEDERGRERGGDAAQQKTPRPECEESRPLSVEKKQRCRLDGKETDGSKFISSNGSDFSDPVYKEIAMTNGCINRMSKEELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKESSAGDSYYDYICIIDFEATCEEGNPAEFLHEIIEFPVVLLNTHTLEIEDTFQQYVRPEVNAQLSEFCIGLTGITQDQVDRADAFPQVLKKVIEWMKSKELGTKYKYCILTDGSWDMSKFLSIQCRLSRLKHPAFAKKWINIRKSYGNFYKVPRSQTKLTIMLEKLGMDYDGRPHSGLDDSKNIARIAVRMLQDGCELRINEKILGGQLMSVSSSLPVEGAPAPQMPHSRK

Tissue specificity:Widely expressed with high levels in spleen, thymus and testis (at protein level). {ECO:0000269|PubMed:18438418}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp