PDPN_MOUSE Q62011
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62011
Recommended name：Podoplanin
EC number：
Alternative names：(Glycoprotein 38) (Gp38) (OTS-8) (PA2.26 antigen) (Transmembrane glycoprotein E11) (E11)
Cleaved into：
GeneID：14726
Gene names (primary )：Pdpn
Gene names (synonym )：Gp38 Ots8
Gene names (ORF )：
Length：172
Mass：18233
Sequence：MWTVPVLFWVLGSVWFWDSAQGGTIGVNEDDIVTPGTGDGMVPPGIEDKITTTGATGGLNESTGKAPLVPTQRERGTKPPLEELSTSATSDHDHREHESTTTVKVVTSHSVDKKTSHPNRDNAGDETQTTDKKDGLPVVTLVGIIVGVLLAIGFVGGIFIVVMKKISGRFSP
Tissue specificity：Detected at high levels in lung and brain, at lower levels in kidney, stomach, liver, spleen and esophagus, and not detected in skin and small intestine. Expressed in epithelial cells of choroid plexus, ependyma, glomerulus and alveolus, in mesothelial cells and in endothelia of lymphatic vessels. Also expressed in stromal cells of peripheral lymphoid tissue and thymic epithelial cells. Detected in carcinoma cell lines and cultured fibroblasts. Expressed at higher levels in colon carcinomas than in normal colon tissue. {ECO:0000269|PubMed:10574709, ECO:0000269|PubMed:12032185, ECO:0000269|PubMed:14522983}.
Induction：Down-regulated by treatment with puromycin aminonucleoside (PubMed:12032185). Up-regulated during progression to highly aggressive tumors and during epithelial-mesenchymal transition (EMT) (PubMed:20962267). {ECO:0000269|PubMed:12032185, ECO:0000269|PubMed:20962267}.
Developmental stage：At 12.5 dpc and 13.5 dpc is expressed in the endothelial cells of forming lymph sacs. {ECO:0000269|PubMed:20110424}.
Protein families：Podoplanin family