IPMK_RAT Q99NI4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99NI4
Recommended name：Inositol polyphosphate multikinase 1 Publication
EC number：EC:2.7.1.140
Alternative names：Inositol 1,3,4,6-tetrakisphosphate 5-kinase
Cleaved into：
GeneID：171458
Gene names (primary )：Ipmk
Gene names (synonym )：Impk, Ipk2 1 Publication
Gene names (ORF )：
Length：396
Mass：44,410
Sequence：MAAEPPALRLRPPGSTGDSPPVPRLLGGCVPLSHQVAGHMYGKDKVGILQHPDGTVLKQLQPPPRGPRELEFYTMVYAADCADAVLLELRKHLPKYYGVWSPPSAPNDVYLKLEDVTHKFNKPCIMDVKIGRKSYDPFASAEKIQQQVSKYPLMEEIGFLVLGMRVYHLHSDSYETQNQHYGRGLTKETLKEGVSKFFHNGFCLRKDAVAASIQKVEKILQWFENQKQLNFYASSLLFVYEGSSQPATTKSNDRTLAGRFLSKGALSDADVLECNNNFHLFSSPANGTSVGKSLSKAYSRHRKLYAKKHQSQTSLKVETLEQDNGWKSMSQEHLNGNVLSQLEKVFYHLPAGRQEIAEAEVRMIDFAHVFPSNTVDEGYVYGLKHLIAVLRSILDS
Tissue specificity：Highly expressed in kidney, and at lower levels in hippocampus, brain cortex, cerebellum, heart and lung. 1
Induction：
Developmental stage：
Protein families：