NPNT_MOUSE   Q91V88


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91V88

Recommended name:Nephronectin

EC number:

Alternative names:(Preosteoblast EGF-like repeat protein with MAM domain)

Cleaved into:

GeneID:114249

Gene names  (primary ):Npnt

Gene names  (synonym ):Neph1 Poem

Gene names  (ORF ):

Length:561

Mass:61490

Sequence:MAVLLAAVLASSLYLQVAADFDGRWPRQIVSSIGLCRYGGRIDCCWGWARQSWGQCQPVCQPQCKHGECVGPNKCKCHPGFAGKTCNQDLNECGLKPRPCKHRCMNTFGSYKCYCLNGYMLLPDGSCSSALSCSMANCQYGCDVVKGQVRCQCPSPGLQLAPDGRTCVDIDECATGRVSCPRFRQCVNTFGSYICKCHTGFDLMYIGGKYQCHDIDECSLGQHQCSSYARCYNIHGSYKCQCRDGYEGDGLNCVYIPKVMIEPSGPIHMPERNGTISKGDGGHANRIPDAGSTRWPLKTPYIPPVITNRPTSKPTTRPTPNPTPQPTPPPPPPLPTEPRTTPLPPTPERPSTRPTTIAPATSTTTRVITVDNRIQTDPQKPRGDVFIPRQPTNDLFEIFEIERGVSADEEVKDDPGILIHSCNFDHGLCGWIREKDSDLHWETARDPAGGQYLTVSAAKAPGGKAARLVLRLGHLMHSGDLCLSFRHKVTGLHSGTLQVFVRKHGTHGAALWGRNGGHGWRQTQITLRGADVKSVIFKGEKRRGHTGEIGLDDVSLKRGRC

Tissue specificity:Expressed in kidney (at protein level). {ECO:0000269|PubMed:11470831}.

Induction:

Developmental stage:Expressed from 10.5 dpc onward mainly at epithelial-mesenchymal interfaces in kidney and other tissues undergoing morphogenesis (at protein level). {ECO:0000269|PubMed:11470831, ECO:0000269|PubMed:11546798}.

Protein families:Nephronectin family


   💬 WhatsApp