NR1D1_RAT Q63503
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63503
Recommended name:Nuclear receptor subfamily 1 group D member 1
EC number:
Alternative names:
Cleaved into:
GeneID:252917
Gene names (primary ):Nr1d1
Gene names (synonym ):
Gene names (ORF ):
Length:615
Mass:66,693
Sequence:MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDSSNGSFQSLTQGCPTYFPPSPTGSLTQDPARSFGTVPPSLSDDSSPSSASSSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKGTSNITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRINRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQNAMNLANNQLSSLCPLETSPAPHPTSGSVGPSPPPAPAPTPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIFTYAHDKLGTSPGNFNANHASGSPPATTPQCWESQGCPSTPNDNNLLAAQRHNEALNGLRQGPSSYPPTWPSGPAHHSCHQPNSNGHRLCPTHVYSAPEGKAPANGLRQGNTKNVLLACPMNMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVLMVRFASLFNVKDQTVMFLSRTTYSLQELGAMGMGDLLNAMFDFSEKLNSLALTEEELGLFTAVVLVSADRSGMENSASVEQLQKTLLRALRALVLKNRPSETSRFTKLLLKLPDLRTLNNMHSEKLLSFRVDAQ
Tissue specificity:In bladder smooth muscle cells, exhibits night/day variations with a peak time at circadian time (CT) 4-12 and a trough at CT16-24. 1
Induction:
Developmental stage:
Protein families:nuclear hormone receptor family