TM100_MOUSE Q9CQG9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CQG9
Recommended name：Transmembrane protein 100
EC number：
Alternative names：
Cleaved into：
GeneID：67888
Gene names (primary )：Tmem100
Gene names (synonym )：
Gene names (ORF )：
Length：134
Mass：14504
Sequence：MTEESTKENLGAPKSPTPVTMEKNPKREVVVTTGPLVSEVQLMAATGGAELSCYRCIIPFAVVVFITGIVVTAVAYSFNSHGSIISIFGLVLLSSGLFLLASSALCWKVRQRNKKVKRRESQTALVVNQRCLFA
Tissue specificity：Expressed in dorsal root ganglia. Expressed in neurons as well as nerve fiber bundles connecting ganglia and fibers innervating muscle layer of the gastric body, jejunum, and proximal colon. Expressed in arterial endothelial cells and neurons of the central nervous system and peripheral nervous system (at protein level). Expressed strongly in lung, weakly in brain, heart and muscle. Expressed in enteric neurons and vascular tissue in the muscularis propria of the gastrointestinal tract. {ECO:0000269|PubMed:22783020, ECO:0000269|PubMed:23485812, ECO:0000269|PubMed:25640077}.
Induction：
Developmental stage：Expressed in embryo at 8.5 dpc. Expressed in arterial endothelial cells of the pharyngeal arch artery and endocardium at 9.5 dpc, onward. Expressed in dorsal aorta, pharyngeal arch and primitive internal carotid arteries at 11.5 dpc. Expressed also in intersomitic, mesenchephalic, metencephalic and anterior choroidal arteries at 12.5 dpc. Expressed in the ventral neural tube of the embryo. {ECO:0000269|PubMed:20848592, ECO:0000269|PubMed:22783020}.
Protein families：