DPOD4_MOUSE Q9CWP8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CWP8
Recommended name：DNA polymerase delta subunit 4
EC number：
Alternative names：(DNA polymerase delta subunit p12)
Cleaved into：
GeneID：69745
Gene names (primary )：Pold4
Gene names (synonym )：
Gene names (ORF )：
Length：107
Mass：12403
Sequence：MGRKRFITDSYPVVKKREGPPGHSKGELAPELGEDTQSLSQEETELELLRQFDLAWQYGPCTGITRLQRWSRAEQMGLKPPLEVYQVLKAHPEDPHFQCSLWHLYPL
Tissue specificity：
Induction：In response to DNA damage or genotoxic stress, such as UV irradiation or treatment with an alkylating agent, protein expression drastically drops. {ECO:0000269|PubMed:23233665}.
Developmental stage：
Protein families：DNA polymerase delta subunit 4 family