SHCBP_MOUSE Q9Z179
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z179
Recommended name：SHC SH2 domain-binding protein 1
EC number：
Alternative names：(Protein expressed in activated lymphocytes) (mPAL) (SHC-binding protein)
Cleaved into：
GeneID：20419
Gene names (primary )：Shcbp1
Gene names (synonym )：Pal
Gene names (ORF )：
Length：668
Mass：75917
Sequence：MADDLRAGGVLEPIAMVPPRPDLAAEKEPASWKEGLFLDADPCSDQGYHANPGATVKTLIPEGKTPFPRIIQTNELLFYERFRAYQDYILADCKASEVKEFTVSFLEKVLEPSGWWAVWHTNVFEVLVEVTNVDFPSLKAVVRLAEPCIYESKLSTFTLANVKELLDLKEFHLPLQELWVVSDDSHEFHQMALAIEHVRFFYKHIWRSWDEEEEDEYDYFVRCVEPRLRLYYDILEDRVPSGLIVDYHNLLSQCEESYRKFLNLRSSLSNCNSDSEQENISMVEGLNLYSEIEQLKQKLKLIENPLLRYVFGYQKNSNIQGKGTRQNGQKVIHVVSSTMKTGLLRSLFKDRFCEESCKEETEIKFHSDLLSGINACYDGDTVIICPGHYVVHGTCSIADSIELEGYGLPDDIVIEKRGKGDTFVDCTGMDVKISGIKFIQHDSVEGILIIHHGKTTLENCVLQCETTGVTVRTSAELFMKNSDVYGAKGAGIEIYPGSKCTLTDNGIHHCKEGILIKDFLDEHYDIPKISMINNVIHNNEGYGVVLVKPTIFCDLQENTQDEINDNMVQKNKEADVTEGLDLEEMLQCVASKMEPYATADFNEQAKGNCEIINELLAISMQKGRMKKRLSELGITQADDNIMSQEMFIEIMGNQFKWNGKGSFGTFLY
Tissue specificity：Expressed in spleen, lung and heart with higher expression in testis. No expression in brain, liver and skeletal muscle. Elevated expression in actively cycling cells. {ECO:0000269|PubMed:10086341}.
Induction：Down-regulated upon growth inhibition. {ECO:0000269|PubMed:10086341}.
Developmental stage：
Protein families：