E2F2_MOUSE P56931
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P56931
Recommended name：Transcription factor E2F2
EC number：
Alternative names：(E2F-2)
Cleaved into：
GeneID：242705
Gene names (primary )：E2f2
Gene names (synonym )：
Gene names (ORF )：
Length：443
Mass：48499
Sequence：MLRAPRTLAPATAQPTKSLPALNPTELWPSGLSSPQLCPATTATTYYTSLYTQTVPSSVALGTCLDATPHGPEGQIVRCAPAGRLPAKRKLDLEGIGRPTVPEFRTPKGKCIRVDGLPSPKTPKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQLIRKKSKNNIQWVGRELFEDPTRPSRQQQLGQELKELMNAEQTLDQLIQSCSLSFKHLTEDNANKKLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRAEENLQIYLKSTQGPIEVYLCPEEGQEPDSPAKEALPSTSALSPIPDCAQPGCSTDSGIAETIEPSVLIPQPIPPPPPPPLPPAPSLVPLEATDNMLELSHPLLQQTEDQFLSPILAANSPLISFSPPLDQDEYLWGMDEGEGISDLFDSYDLGDLLIN
Tissue specificity：
Induction：
Developmental stage：Expressed in the developing epidermis and intestinal epithelium. First detected in the epidermis at stage 13.5-14.5 dpc with higher levels in the head and thorax regions. At 15.5 dpc, expression is found in both the epithelium and, to a lesser extent in the underlying mesenchyme. At day 16.5 dpc, high expression in the basal cells. Later expression is found in the developing hair follicles, around the dermal papillae. In the developing intestinal epithelium, expression first observed around 14.5 dpc. Levels continue to increase at least until 19.5 dpc, with highest levels in the intervillus epithelium and in the bottom half of the villi. In the nervous system, first expressed at 9.5 dpc, in the forebrain. At 10.5 dpc, expressed broadly in the brain, and at lower levels in the upper regions of the spinal cord. By 11.5 dpc, E2F2 expression is found throughout the central nervous system and levels peak at 12.5-15.5 dpc. In the developing spinal cord, E2F2 expression found only in the dorsal region. In the developing retina, highest expression found in the 14.5-18.5 dpc embryonic retinoblastic cell layer. In other developing tissues, E2F2 is found highest in thymus and liver, with lower expression in lung, heart, kidney and skeletal muscle. Also found in choroid plexus and chondrocytes. {ECO:0000269|PubMed:9149906, ECO:0000269|PubMed:9376316}.
Protein families：E2F/DP family