RPC9_RAT   Q8VHM6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8VHM6

Recommended name:DNA-directed RNA polymerase III subunit RPC9

EC number:

Alternative names:Calcitonin gene-related peptide-receptor component protein (CGRP-RCP; CGRP-receptor component protein; CGRPRCP)

Cleaved into:

GeneID:114205

Gene names  (primary ):Crcp

Gene names  (synonym ):

Gene names  (ORF ):

Length:148

Mass:16,627

Sequence:MEVKDANAALLSNYEVFQLLTDLKEQRKESGKNKHSAGQQNLNAITYETLKYISKTPCKNQSPAIVQEFLTAMKSHKLTKAEKLQLLNHRPMTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAGPEDEQSKSTSNDAAMEEEEPA

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp