LDAF1_MOUSE Q922Z1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q922Z1
Recommended name：Lipid droplet assembly factor 1
EC number：
Alternative names：(Promethin) (Transmembrane protein 159)
Cleaved into：
GeneID：233806
Gene names (primary )：Tmem159
Gene names (synonym )：Ldaf1
Gene names (ORF )：
Length：161
Mass：17643
Sequence：MAKEEPPSVSRDLQELQRKLGLLLESFLNNSKVVAFMKSPVGRFLDRHPFVTLTVLMFVTMSAIPVGFFLLIVVLTSLGALMGAILLEGLVISVCGLSLLCVLCGLGFLSLALSGIAMMSYVVVSCLMSYWFSPSRPLTQQNANVDCQLAMKFTESERLIF
Tissue specificity：Prominently expressed in the heart and kidney. Expressed at higher levels in white fat as compared to brown fat and skeletal muscle. Expressed at lower levels in lung, liver and testis. {ECO:0000269|PubMed:15589683}.
Induction：In liver with hepatic adiposis caused by PPAR gamma 1 overexpression (PubMed:15589683). Up-regulated during adipogenesis (PubMed:30901948). {ECO:0000269|PubMed:15589683, ECO:0000269|PubMed:30901948}.
Developmental stage：
Protein families：LDAF1 family