PERM1_MOUSE   Q149B8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q149B8

Recommended name:PGC-1 and ERR-induced regulator in muscle protein 1

EC number:

Alternative names:(PPARGC1 and ESRR-induced regulator in muscle 1) (Peroxisome proliferator-activated receptor gamma coactivator 1 and estrogen-related receptor-induced regulator in muscle 1)

Cleaved into:

GeneID:74183

Gene names  (primary ):Perm1

Gene names  (synonym ):

Gene names  (ORF ):

Length:807

Mass:85157

Sequence:MDNFQYSVQLSDREWAEFSATADECGLLQADLASGDEPLSSDIDQGDSSGSSPPGPPPLFTGQLVSQGRGQQSRELEDVAAQQLVSRSQCEPVLALEASHQVAGTSTQSEAPLFPSLDSVCPGQALSFPGPATCRDKMQRLLQGPAPSSPSKAPHSPESPGHSDNPQSSPDSLEASPRNPGRKKRRAVGAKGTKHSGSLDSAATQMSSPQLTRPKEALMSGTLMAKAQQDKPQPDSTSPEQMAREESGLDLSTPILITEQDQIRKTSRAALHVVSKPVQEVHPDVPMASPNVSTRASKPQPDVALPKPASKPQSDIASSTHPFTPDVSLSTLAFKCQPNTNQSTPASEPDMALSTPASEPDTALSTPASEPDTALSTPASEPDTALSTPASRSQLVKAEFASACTPGLHVDLSAAGSEIKPEVSSSMPAAVDVLRTDLPRSVSKTESKESVSIPVKPSLSPISQAEAAMVDTGVSVPPGGSIEKPAGQFSAGSSGESCLGPVQAPKKKKVRFSMAIPSHEDSGSGEPTGSPFLTPEQPPVPRTAAGSRGGSAAWDAVAVAPRLPQPRILKHLPPPVSSVSAEAESGNCFAVTLPEAYEFFFCDTIEEEDEDVEDEEAASQALDEVQWPDTCEFFFRDSRAQRSRCQRGHSPVSPPRADTVAPVPPEGLVPISIPEVYEHFFTEEGFGHRQPAATPMQTSELSREGGLEASTKPVSPTAEHLSLTVRKAGELRSPLTSFTFSQNDMCLVFVAFATWAVRTSDLQAPDAWKTVLLANIGTISAIRYFRRQVGRGHSGRPRSSSSSNPSC

Tissue specificity:Highly expressed in skeletal muscles and heart with lower levels in brown adipose tissue (at protein level). Muscle-specific expression is increased by endurance exercise. {ECO:0000269|PubMed:23836911}.

Induction:By PPARGC1A, PPARGC1B, ESRRA, ESRRB and ESRRG. {ECO:0000269|PubMed:23836911}.

Developmental stage:

Protein families:


   💬 WhatsApp