SSLP1_MOUSE   Q3UN54


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3UN54

Recommended name:Secreted seminal-vesicle Ly-6 protein 1

EC number:

Alternative names:(SSLP-1)

Cleaved into:

GeneID:235973

Gene names  (primary ):Sslp1

Gene names  (synonym ):Gm191

Gene names  (ORF ):

Length:99

Mass:11155

Sequence:MEKYLLLLLLGIFLRVGFLQALTCVSCGRLNSSGICETAETSCEATNNRKCALRLLYKDGKFQYGFQGCLGTCFNYTKTNNNMVKEHKCCDHQNLCNKP

Tissue specificity:Predominantly expressed in the seminal vesicles. {ECO:0000269|PubMed:16940290}.

Induction:By testosterone. {ECO:0000269|PubMed:16940290}.

Developmental stage:Expressed from 3 weeks onwards. {ECO:0000269|PubMed:16940290}.

Protein families:


   💬 WhatsApp