GKN1_MOUSE Q9CR36
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CR36
Recommended name：Gastrokine-1
EC number：
Alternative names：(18 kDa antrum mucosa protein) (AMP-18) (Protein CA11 homolog)
Cleaved into：
GeneID：66283
Gene names (primary )：Gkn1
Gene names (synonym )：Amp18 Ca11
Gene names (ORF )：
Length：201
Mass：21887
Sequence：MSVSTPPDPLLHHTPAAMKLTMFVVGLLGLLAAPGFAYTVNINGNDGNVDGSGQQSVSINGVHNVANIDNNNGWDSWNSLWDYENSFAATRLFSKKSCIVHRMNKDAMPSLQDLDTMVKEQKGKGPGGAPPKDLMYSVNPTRVEDLNTFGPKIAGMCRGIPTYVAEEIPGPNQPLYSKKCYTADILWILRMSFCGTSVETY
Tissue specificity：Highly expressed specifically in surface cells of the antrum mucosa from where it is secreted. {ECO:0000269|PubMed:12851218}.
Induction：
Developmental stage：
Protein families：Gastrokine family