ELA_MOUSE P0DMC4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P0DMC4
Recommended name：Apelin receptor early endogenous ligand
EC number：
Alternative names：(Protein Elabela) (ELA) (Protein Toddler)
Cleaved into：
GeneID：100038489
Gene names (primary )：Apela
Gene names (synonym )：Ela Ende Gm10664 Tdl
Gene names (ORF )：
Length：54
Mass：6828
Sequence：MRFQPLFWVFFIFAMSLLFISEQKPVNFPRRRKLYRHNCFRRRCIPLHSRVPFP
Tissue specificity：Expressed in the placenta (PubMed:28663440). Expressed in syncytiotrophoblasts of the placenta labyrinth at 10.5 dpc (PubMed:28663440). Expressed in placental chorionic trophoblasts (at protein level) (PubMed:28663440). Expressed in a small population of epiblast cells in the distal half of the embryo at 7 dpc (PubMed:20153842, PubMed:28854362). Expressed in newly formed definitive endoderm cells in the proximal half of the embryo, while it is not present in extra-embryonic endoderm at 7.5 dpc (PubMed:20153842, PubMed:28854362). This expression pattern then changes to the ventral aspect of the developing foregut pocket and the entire hindgut pocket at 8.5 dpc, before becoming restricted to the foregut overlying the heart and the posterior-most hindgut (PubMed:20153842). Not detected in endothelial precursor cells of the yolk sac at 8 dpc (PubMed:28663440). Expressed in extraembryonic tissues as well as in the chorion at 8.25 dpc (PubMed:28854362). Expressed in endometrial stroma of the uterus of pregnant mice at 8.5 dpc (PubMed:28663440). Expressed in the developing heart, caudal neural tube and trophobasts at 9 dpc (PubMed:28663440). Expressed in the chorionic plate of the chorioallantoic placenta at 9 dpc (PubMed:28663440). Expressed in the posterior half of the ventral neural tube at 9.25 dpc (PubMed:20153842). Expressed in trophoblast cells at the periphery of the placenta at 9.5 dpc (PubMed:28854362). Expressed in collecting ducts of the kidney of pregnant mice at 10.5 dpc (PubMed:28663440). Expressed in the epicardium of the developing heart at 11.5 dpc (PubMed:26611206, PubMed:28890073). Expressed weakly in the adult heart (PubMed:26611206). Expressed in endothelial cells and fibroblasts and weakly in cardiomyocytes (PubMed:26611206). {ECO:0000269|PubMed:20153842, ECO:0000269|PubMed:26611206, ECO:0000269|PubMed:28663440, ECO:0000269|PubMed:28854362, ECO:0000269|PubMed:28890073}.
Induction：Up-regulated following myocardial infarction (MI) (at protein level) (PubMed:26611206). {ECO:0000269|PubMed:26611206}.
Developmental stage：Expressed during early embryonic development from the two cell to blastocyst stages (PubMed:28663440). Expressed in populations of the definitive endoderm from 7 to 8.5 dpc (PubMed:20153842). {ECO:0000269|PubMed:20153842, ECO:0000269|PubMed:28663440}.
Protein families：Elabela/Toddler family