THTM_MOUSE   Q99J99


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99J99

Recommended name:3-mercaptopyruvate sulfurtransferase

EC number:EC 2.8.1.2

Alternative names:(MST) (EC 2.8.1.2)

Cleaved into:

GeneID:246221

Gene names  (primary ):Mpst

Gene names  (synonym ):

Gene names  (ORF ):

Length:297

Mass:33097

Sequence:MAAPQLFRALVSAQWVAEALKAPRSSQPLKLLDASWYLPKLGRDARREFEERHIPGAAFFDIDRCSDHTSPYDHMLPNATHFADYAGSLGVSAATHVVIYDDSDQGLYSAPRVWWMFRAFGHHSVSLLDGGFRHWLNQNLPISSGKSHSEPAEFSAQLDPSFIKTHEDILENLDARRFQVVDARAAGRFQGTQPEPRDGIEPGHIPGSVNIPFTEFLTNEGLEKSPEEIKRLFKEKKVDLSKPLVATCGSGVTACHVVLGAFLCGKSDVPVYDGSWVEWYMRAQPEHIISEGRGKTQ

Tissue specificity:Expressed in the brain and retina. In the retina, localized to the inner and outer plexiform layer, the inner and outer nuclear layer and the outer segments of photoreceptors. In the brain, localized to neurons of mitral cell layers, glomerular, and external plexiform layers in the olfactory bulb. Also found in Purkinje cell stomata and proximal dendrites. In the spinal cord, localized to large neurons. In the cerebral cortex, localized to pyramidial neurons in layers II/III and V, and in layers I-VI of neocortical areas. In the hippocampus, found in CA1 and CA3 pyramidal cells. {ECO:0000269|PubMed:18855522, ECO:0000269|PubMed:21937432, ECO:0000269|PubMed:22808324}.

Induction:

Developmental stage:In the developing brain, maintained expression from 16 dpc to postnatal day 14. Levels decrease between postnatal day 28 and postnatal day 52 and increase again with further aging up to 156 days old. {ECO:0000269|PubMed:18855522}.

Protein families:


   💬 WhatsApp