NRN1_MOUSE Q8CFV4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8CFV4
Recommended name：Neuritin
EC number：
Alternative names：(Candidate plasticity gene 15 protein)
Cleaved into：
GeneID：68404
Gene names (primary )：Nrn1
Gene names (synonym )：Cpg15
Gene names (ORF )：
Length：142
Mass：15353
Sequence：MGLKLNGRYISLILAVQIAYLVQAVRAAGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSSNGAAGSLLPALSVLLVSLSAALATWFSF
Tissue specificity：Expressed in the brain (at protein level). {ECO:0000269|PubMed:22632720}.
Induction：By synaptic activity through NMDA receptors and L-type voltage-sensitive calcium channels. By cAMP in active neurons. {ECO:0000269|PubMed:14664806}.
Developmental stage：
Protein families：Neuritin family