ACSM3_MOUSE Q3UNX5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3UNX5
Recommended name：Acyl-coenzyme A synthetase ACSM3, mitochondrial
EC number：EC 6.2.1.2
Alternative names：(Acyl-CoA synthetase medium-chain family member 3) (Butyrate--CoA ligase 3) (Butyryl-coenzyme A synthetase 3) (Middle-chain acyl-CoA synthetase 3) (Propionate--CoA ligase) (Protein SA homolog)
Cleaved into：
GeneID：20216
Gene names (primary )：Acsm3
Gene names (synonym )：Sa Sah
Gene names (ORF )：
Length：580
Mass：65623
Sequence：MVMLLRARCFQRLAIPDPMRVLYKDYRTATPQNFSNYESMKQDFKIEIPEYFNFAKDVLDQWTNMEKAGKRLSNPAFWWIDGNGEELRWSFEELGLLSRKFANILTEACSLQRGDRVMVILPKIPEWWLANVACLRTGTVLIPGTTQLTQKDILYRLQSSKAKCIITDDTLAPAVDAVAAKCENLHSKLIVSQHSREGWGNLKEMMKYASDSHTCVDTKHDEMMAIYFTSGTTGPPKMIGHTHSSFGLGLSVNGRFWLDLIASDVMWNTSDTGWAKSAWSSVFSPWTQGACVFAHYLPRFESTSILQTLSKFPITVFCSAPTAYRMLVQNDMSSYKFNSLKHCVSAGEPINPEVMEQWRKKTGLDIYEGYGQTETVLICGNFKGMKIKPGSMGKPSPAFDVKILDENGATLPPGQEGDIALQVLPERPFGLFTHYVDNPSKTASTLRGSFYITGDRGYMDEDGYFWFVARSDDIILSSGYRIGPFEVESALIEHPSIAESAVVSSPDPIRGEVVKAFIVLNPDYKSHDQEQLKKEIQEHVKKTTAPYKYPRKVEFIEELPKTVSGKVKRNELRKKEWVTT
Tissue specificity：Detected in kidney (at protein level). Detected in kidney proximal tubules and in liver. Detected at low levels in testis, stomach, heart and lung. {ECO:0000269|PubMed:11470804, ECO:0000269|PubMed:15525578, ECO:0000269|PubMed:9449642, ECO:0000269|PubMed:9507200}.
Induction：Up-regulated in kidney by androgens. Down-regulated in kidney by estrogens. Levels in kidney are very low in female C57BL/6 mice and in castrated male C57BL/6, 129/SvJ and BALB/c mice. Constitutively expressed in liver. {ECO:0000269|PubMed:15525578, ECO:0000269|PubMed:9449642}.
Developmental stage：
Protein families：ATP-dependent AMP-binding enzyme family