FA2H_RAT Q2LAM0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q2LAM0
Recommended name：Fatty acid 2-hydroxylase 1 Publication
EC number：EC:1.14.18.-
Alternative names：Fatty acid alpha-hydroxylase 1 Publication
Cleaved into：
GeneID：307855
Gene names (primary )：Fa2h 1 Publication
Gene names (synonym )：Faah
Gene names (ORF )：
Length：372
Mass：42,673
Sequence：MAPAPPPAASFTSAEVQRRLAAGACWVRRGASLYDLTGFVRHHPGGEQLLLARAGQDISADLDGPPHKHSDNARRWLEQYYVGELRADPQDPTENGAGAPAETQKTDAAIEPQFKVVDWDKDLVDWQKPLLWQVGHLGEKYDEWVHQPVARPIRLFHSDLIEAFSKTVWYSVPIIWVPLVLYLSWSYYRTLTQDNIRLFASFTRDYSLVVPESVFIGLFVLGMLIWTLVEYLIHRFLFHMKPPSNSHYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASVVVAFFYVFLRLILPEAVAGILFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYNMKAHHVKHHFEYQKSGFGISTKLWDYFFHTLIPEEADPKMQ
Tissue specificity：Detected in oligodendrocytes (at protein level). Detected in sciatic nerve. 2 s
Induction：Detected at low levels in sciatic nerve from newborns. Levels increase strongly during the first 3 weeks, and decrease thereafter to reach a low, constitutive level in 4 week olds. Expressed at a low, constitutive level in adults. 1 Publication
Developmental stage：Up-regulated in sciatic nerve during myelination. Up-regulated in differentiating cultured Schwann cells. 1
Protein families：