IFM2_MOUSE Q99J93
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99J93
Recommended name：Interferon-induced transmembrane protein 2
EC number：
Alternative names：(Dispanin subfamily A member 2c) (DSPA2c) (Fragilis protein 3)
Cleaved into：
GeneID：80876
Gene names (primary )：Ifitm2
Gene names (synonym )：
Gene names (ORF )：
Length：144
Mass：15743
Sequence：MSHNSQAFLSTNAGLPPSYETIKEEYGVTELGEPSNSAVVRTTVINMPREVSVPDHVVWSLFNTLFFNACCLGFVAYAYSVKSRDRKMVGDVVGAQAYASTAKCLNISSLIFSILMVIICIIIFSTTSVVVFQSFAQRTPHSGF
Tissue specificity：Predominantly expressed in nascent primordial germ cells, as well as in gonadal germ cells. {ECO:0000269|PubMed:12659663}.
Induction：
Developmental stage：From 5.5 dpc to 7.5 dpc expressed within the epiblast. At 8.5 dpc expressed throughout the entire embryo. Expressed in the gonadal germ cells at 11.5 dpc/12.5. {ECO:0000269|PubMed:12659663}.
Protein families：CD225/Dispanin family