KAD2_MOUSE Q9WTP6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WTP6
Recommended name：Adenylate kinase 2, mitochondrial
EC number：EC 2.7.4.3
Alternative names：(AK 2) (ATP-AMP transphosphorylase 2) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase)
Cleaved into：
GeneID：11637
Gene names (primary )：Ak2
Gene names (synonym )：
Gene names (ORF )：
Length：239
Mass：26469
Sequence：MAPNVLASEPEIPKGIRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPSCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIQDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKTRLEAYHTQTTPLVEYYRKRGIHCAIDASQTPDIVFASILAAFSKATCKDLVMFI
Tissue specificity：Present in the inner ear. Not detected in the vestibule at any developmental stage. Present at high level in the cochlea uniquely in the stria vascularis at postnatal day 7 but not at birth. Present within the lumen of the stria vascularis capillaries. Not detected in the capillaries or vessels of the adjacent connective tissue (at protein level). {ECO:0000269|PubMed:19043416}.
Induction：
Developmental stage：
Protein families：Adenylate kinase family, AK2 subfamily