STX19_MOUSE Q8R1Q0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R1Q0
Recommended name：Syntaxin-19
EC number：
Alternative names：(Syntaxin-9)
Cleaved into：
GeneID：68159
Gene names (primary )：Stx19
Gene names (synonym )：Syn9
Gene names (ORF )：
Length：292
Mass：33867
Sequence：MKDRLQELKQKTKEIELSRDGQVFVEEEQGVLVQQAVIYEREPVAERHLHEIQKLQENINSFVDDVQRFGQQQKSLVASMRRFSLLKRDSTIAKEIKIQAEHINRALGDVVKEVKKSEVENGPSSVVTRILKSQYAAMFRRFQQTMFLYNDTIALKQEKCKTFIVRQLEVAGKEVSEEEVNDMLHHGKWEVFNESLLTETSITKAQLSEIEQRHKELVNLENQVKDLRDLFIQISLLVEEQGESINSIEVMVNSTKDYVNNTKEKFGLAVKYKKRNPCRALCCCCCPRCGSK
Tissue specificity：Expressed in stomach, lung and skin (at protein level). In stomach, strongly expressed in the mucosa of the fundus, in epithelial cells of gastric pits, and in gastric glands (at protein level). In skin, expressed in the epidermis, dermis, and epithelial layer of the hair bulb (at protein level). {ECO:0000269|PubMed:16420529}.
Induction：
Developmental stage：Detected in stomach and skin from embryonic stage 16 (16 dpc) onwards. {ECO:0000269|PubMed:16420529}.
Protein families：Syntaxin family