HILS1_MOUSE Q9QYL0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QYL0
Recommended name：Spermatid-specific linker histone H1-like protein
EC number：
Alternative names：(TISP64)
Cleaved into：
GeneID：54388
Gene names (primary )：Hils1
Gene names (synonym )：H1-9p
Gene names (ORF )：
Length：170
Mass：19203
Sequence：MAQMVAGDQDAGTLWVPSQSESQTESDISTQSLRKPTMSYVILKTLADKRVHNCVSLATLKKAVSITGYNMTHNTWRFKRVLQNLLDKGMIMHVTCCKGASGSLCLCKERALKSNHRAKRCQDRQKSQKPQKPGQRESEPCQLLLSSKKKNDQLFKGVRRVAKGNRHCHY
Tissue specificity：Expressed exclusively in the testis by haploid germ cells (at protein level). {ECO:0000269|PubMed:12920187, ECO:0000269|PubMed:14636221}.
Induction：
Developmental stage：Expression initiated at step 9 of spermatid development and peaked between steps 10-13. Expression decreased abruptly at step 14 and was undetectable after step 15. {ECO:0000269|PubMed:14636221}.
Protein families：Histone H1/H5 family