PTH2R_RAT   P70555


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P70555

Recommended name:Parathyroid hormone 2 receptor

EC number:

Alternative names:

Cleaved into:

GeneID:81753

Gene names  (primary ):Pth2r

Gene names  (synonym ):Pthr2

Gene names  (ORF ):

Length:546

Mass:61,804

Sequence:MPWLEALPYICGWLILRSCLLVGAQLDSDGTITIEEQIVLVMKAKMQCELNITAQFQEGEGNCFPEWDGLICWPRGTAGKTSAMPCPSYVYDFNHKGVAFRHCTPNGTWDFIHGSNKTWANYSDCFLQPDINIGKQEFFENLYILYTVGYSISFGSLAVAILIIGYFRRLHCTRNYIHLHLFVSFMLRAXSIFVKDRVAQAHLGVEALQSLVMQGDLQNFIGGPSVDKSQYVGCKIAVVMFIYFLATNYYWILVEGLYLHNLIFVSFFSDTKYLWGFILIGWGFPAVFVVAWAVARATLADTRCWELSAGDRWIYXXPILAAIGLNFILFLNTVRVLATKIWETNAVGHDMRKQYRKLAKSTLVLVLVFGVHYIVFICQPHSFSGLWWEIRMHCELFFNSFQGFFVSIVYCYCNGEVQAEVKKTWTRWNLSIDWKKAPPCGGHRYGSVLTTVTHSTSSQSQMGPSTRLVLISSKPAKTACRQIDSHVTLPGYVWSSSEQDCQPQSTPEETKKGHGRQEDDSPVGESSRPVAFTIDTEGCKGESHPI

Tissue specificity:Abundantly expressed in brain, arterial and cardiac endothelium. Found as well in sperm, in the head of the epididymis. Lower expression is found in vascular smooth muscle, exocrine pancreas, testis and placenta.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp