HMGA2_MOUSE P52927
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P52927
Recommended name：High mobility group protein HMGI-C
EC number：
Alternative names：(High mobility group AT-hook protein 2)
Cleaved into：
GeneID：15364
Gene names (primary )：Hmga2
Gene names (synonym )：Hmgic
Gene names (ORF )：
Length：108
Mass：11819
Sequence：MSARGEGAGQPSTSAQGQPAAPVPQKRGRGRPRKQQQEPTCEPSPKRPRGRPKGSKNKSPSKAAQKKAETIGEKRPRGRPRKWPQQVVQKKPAQETEETSSQESAEED
Tissue specificity：Expressed in mitotic spermatogonia, meiotic spermatocytes, and postmeiotic round spermatids (at protein level) (PubMed:14668482). Expressed in embryonic myogenic progenitor cells (PubMed:27446912). {ECO:0000269|PubMed:14668482, ECO:0000269|PubMed:27446912}.
Induction：
Developmental stage：Expressed predominantly during embryogenesis. In myogenic progenitor cells, expressed during early myogenic development (11.5 dpc) to be gradually down-regulated during the fetal stages (17.5 dpc) (PubMed:27446912). {ECO:0000269|PubMed:27446912}.
Protein families：HMGA family