NACA_MOUSE   Q60817


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q60817

Recommended name:Nascent polypeptide-associated complex subunit alpha

EC number:

Alternative names:(Alpha-NAC) (Alpha-NAC/1.9.2)

Cleaved into:

GeneID:17938

Gene names  (primary ):Naca

Gene names  (synonym ):

Gene names  (ORF ):

Length:215

Mass:23384

Sequence:MPGEATETVPATEQELPQPQAETGSGTESDSDESVPELEEQDSTQTATQQAQLAAAAEIDEEPVSKAKQSRSEKKARKAMSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLSQQAQLAAAEKFKVQGEAVSNIQENTQTPTVQEESEEEEVDETGVEVKDIELVMSQANVSRAKAVRALKNNSNDIVNAIMELTM

Tissue specificity:Isoform 1 appears to be ubiquitously expressed. {ECO:0000269|PubMed:10224091, ECO:0000269|PubMed:8698236, ECO:0000269|PubMed:9877153}.

Induction:

Developmental stage:Expressed concomitant with the onset of mineralization in ossification centers of developing bone. {ECO:0000269|PubMed:9488446}.

Protein families:NAC-alpha family


   💬 WhatsApp