KPRP_RAT   Q7TQM5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7TQM5

Recommended name:Keratinocyte proline-rich protein

EC number:

Alternative names:

Cleaved into:

GeneID:432393

Gene names  (primary ):Kprp

Gene names  (synonym ):

Gene names  (ORF ):

Length:699

Mass:76,358

Sequence:MCDQQEIQCCGPIPQCCVKGSSFGPSQFPYANNQVLVEAPCEMQFLECAAPCPIQVSQTPCQSSTTEVKGQAPCKTTNVKCQTKTTQVKCQPKTTEIKCQAPCQAQVSCVQCQAPCQSQVSYVQVPQPPQTYYVECAPVYYTETRFVEYPVSNYVPVPAPQPGYTYVECPSLGQGQGQGSFSTRYQYQGSYGSCTSQSQSRGSYSSCGPQHQSQASYSYCEPQFQSRPSYTNCGTQRQSQASFGSCTSQLQSRASYSNCSSQRRSGTSFSTCAPQCQGQGTYGSFTAQRKSQSASRCLPSRRLQPSYRSCSPPRHSEPCYSSCLPSRCSSGSYNYCTPPRRSEPIYGSHCSPRGRPSGCSQRCGPKCRIEISSPCCPRQVPPQRCPVQIPPIRGRSRSCPRQPSWGVSCPDLRPCAEPHAFPRPCRPQRLDRSPESSWRRCPVPAPRPYPRPEPCPSPEPRPCPRPRPRPEPCPSPEPRPRPRPDPCPSPELRPRPRPEPCPSPEPRPRPRPDPCPSPEPRPRPCPEPCPSPEPRPCPPLRRFSEPCLYPEPCSVSKPVPCPVPCPAPHPRPVHCETPGRRPQPSPRSQPCPHPEPMPRPVPCSSPVPCGDPIHCPSPCSGHNPVPYSQELGCHESNPCRLDTEGPSSYSFSQGQESNGCCVSGGVFSGSRGLSGCGDQGNTYRGMNCGACGGTQGAYF

Tissue specificity:Expressed in the stratified squamous epithelial layers of the skin, esophagus and tongue. 1

Induction:

Developmental stage:Expressed in skin and hair germ cells at 19, 20 and 21 dpc. 1

Protein families:


   💬 WhatsApp