IPO13_RAT Q9JM04
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JM04
Recommended name：Importin-13
EC number：
Alternative names：Late gestation lung 2 protein
Cleaved into：
GeneID：116458
Gene names (primary )：Ipo13
Gene names (synonym )：Imp13, Lgl2
Gene names (ORF )：
Length：963
Mass：108,187
Sequence：MERREEQLGAAGAGAAPALDFTVENVEKALHQLYYDPNIENKNLAQKWLMQAQVSPQAWHFSWQLLQPDKVPEIQYFGASALHIKISRYWSDIPTDQYESLKAHSFTQITRFASGSKIVLTRLCVALASLALSMMPDAWPCAVADMVRLFQAEDSPVDSQGRCLALLELLTVLPEEFQTSRLPQYRKGLVRASLAVECGAVFPLLEQLLQQPSSPSCVRQKVLKCFSSWVQLEVPLQDCEALIQAAFAALQDSELFDSSVEAIVNAISQPDAQRYVNTLLKLIPLVLGLQEQLRQAVQNGDMETSHGICRIAVALGENHSRALLDQVEHWQSFLALVNMIMFCTGIPGHYPVNETTSSLTLTFWYTLQDDILSFEAEKQAVYQQVYRPVYFQLVDVLLHKAQFPSDEEYGFWSSDEKEQFRIYRVDISDTLMYVYEMLGAELLSNLYDKLGRLLTSSEEPYSWQHTEALLYGFQSIAETIDVNYSDVVPGLIGLIPRISISNVQLADTVMFTIGALSEWLADHPVMINSVLPLVLHALGNPELSVSSVSTLKKICRECKYELPPYAANIVAVSQDVLMKQIHKTSQCMWLMQALGFLLSALQVEENLKNLHSLISTYIQQLEKLAEEIPKPSNKLAIVHILGLLSNLFTTLDVSHHEDDHEGPELRKLPVPQGPNPVVVVLQQVFQLIQKVLSKWLSDAQVVEAVCAIFEKSVKTLLDDFAPMVPQLCEMLGRMYSTVPQASALDLTRQLVHIFAHEPAHFPPIEALFLLVTSVTLSLFQQGPRDHPDIVDSFMQLLAQALKRKPDLFQCERLDVKAVFQCAVLALKFPEAPTVKASCGFFTELLPRCGEIESVGKVVQEDGRMLLIAVLEAIGGQASRSLMDCFADILFALNKHCFSLLSMWIKEALQPPGFPSARLSPEQKDTFSQQILRERVNKRRVKEMVKEFTLLCRGLHGTDYTADY
Tissue specificity：Expressed in fetal brain, heart, intestine and kidney. 1
Induction：Differentially expressed in fetal lung with highest levels at gestational days 14 to 16. 1 Publication
Developmental stage：By cortisol. 1
Protein families：