MYOZ2_MOUSE Q9JJW5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JJW5
Recommended name：Myozenin-2
EC number：
Alternative names：(Calsarcin-1) (FATZ-related protein 2)
Cleaved into：
GeneID：59006
Gene names (primary )：Myoz2
Gene names (synonym )：
Gene names (ORF )：
Length：264
Mass：29762
Sequence：MLSHSAMVKQRKQQASAITKEIHGHDVDGMDLGKKVSIPRDIMIEELSHFSNRGARLFKMRQRRSDKYTFENFQYESRAQINHNIAMQNGRVDGSNLEGGSQQGPSTPPNTPDPRSPPNPENIAPGYSGPLKEIPPERFNTTAVPKYYRSPWEQAIGSDPELLEALYPKLFKPEGKAELRDYRSFNRVATPFGGFEKASKMVKFKVPDFELLLLTDPRFLAFANPLSGRRCFNRAPKGWVSENIPVVITTEPTEDATVPESDDL
Tissue specificity：Expressed specifically in heart and skeletal muscle. In skeletal muscle, localized to the soleus and plantaris muscles, which are predominantly composed of slow-twitch fibers. {ECO:0000269|PubMed:11114196}.
Induction：
Developmental stage：At 9.5 dpc, expressed weakly in heart. Higher levels of expression detected at 12.5 dpc and 15.5 dpc in both cardiac and skeletal muscle. {ECO:0000269|PubMed:11114196}.
Protein families：Myozenin family